PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA27009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CPP
Protein Properties Length: 482aa    MW: 52946.2 Da    PI: 6.6519
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA27009genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR36.69e-12323359340
                        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                +++CnC+ s+Clk YCeCfaag++C+e C+C++C Nk+
  Tp57577_TGAC_v2_mRNA27009 323 CRNCNCT-SNCLKPYCECFAAGVYCAEPCTCKGCLNKS 359
                                789***7.89**************************97 PP

2TCR24.65.1e-08405441339
                        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                                +k C+Ckk  C  k C+C + ++ Cs +CkCe+C+N 
  Tp57577_TGAC_v2_mRNA27009 405 SKICHCKKIGCHMKSCSCSKGRVGCSISCKCEGCENM 441
                                688*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.1E-10321361IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163422.687322443IPR005172CRC domain
PfamPF036381.8E-7324358IPR005172CRC domain
SMARTSM011141.6E-4403444IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.6E-5406441IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MMDAPEENKN LPFSNKQEED DYWFHEYIVS LLSVEEAVPI DELLGKQEPG VGYVQDGYMK  60
DSVDVGTKPE LPSCTSSLHE KNAASYQKSL LPSCYTSDSQ RCVLPRNDSY VIALPALNRS  120
SATKTESSSS TSSWLLSASE GNCISQVPAS TERYLGPPEI EVQATKDFTQ SSVHVARSSA  180
RSSARHPESP SNTSFLLPAS QGSLLSSLIP TPTERHLRPS EIEVHATNDF TQSPFHNVRP  240
SPRKLESPSS TSSFLLPASQ GHRLSLIPAL TERHLGPSEI EVQATKDFTQ PSVHIGGEDF  300
GQSIPQRKRK IHNSDITEQG GSCRNCNCTS NCLKPYCECF AAGVYCAEPC TCKGCLNKSI  360
NEYIEIMQTR RNTESSVPHL LVPKVIRSPD TSPPIGDNPN KTPASKICHC KKIGCHMKSC  420
SCSKGRVGCS ISCKCEGCEN MYGRKDNKEL RRESNAFGSQ TKFEKHFQTV PYDDDDSTYI  480
P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-40TESMIN/TSO1-like CXC 2